PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 403aa    MW: 43280.3 Da    PI: 7.7779
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11023genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.47.1e-50111411128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
               +ppGfrFhPt+eel+++yL kkv++++++l  vi+++d++k+ePwd+++  ++ +  +++wy Fs++dkky+tg+r+nrat++g+Wkatg+dk+++s+ ++
  EMT11023  11 VPPGFRFHPTEEELLTYYLVKKVASQRIDL-GVIPDIDLNKLEPWDIQArcRIGTgPQNDWYLFSHKDKKYPTGTRTNRATAAGFWKATGRDKPIYSAaGS 110
               69****************************.99**************953444443456**************************************9777 PP

       NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +g++ktLvfykgrap+g+k+dW+mheyrl
  EMT11023 111 GRIGMRKTLVFYKGRAPRGHKSDWIMHEYRL 141
               88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-557188IPR003441NAC domain
PROSITE profilePS5100555.0311188IPR003441NAC domain
PfamPF023656.2E-2612141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MSISVNGQSV VPPGFRFHPT EEELLTYYLV KKVASQRIDL GVIPDIDLNK LEPWDIQARC  60
RIGTGPQNDW YLFSHKDKKY PTGTRTNRAT AAGFWKATGR DKPIYSAAGS GRIGMRKTLV  120
FYKGRAPRGH KSDWIMHEYR LDDAVPVNPT AGNASYYSSD SFPVRGVAGD QSPSAQEDGW  180
VICRVFKKKN IIVQRQAGQN GGCGAASNKL VGAGAMERSR SNCSSTLTAA SDHTKGQMMP  240
CTASDDGLDH ILSYTGHSST SSCRHQTKPA NPSSSALDHL INSACHSSSS TLYDKFMKLP  300
PLEHVVPGGL LPPLTEYGGD WDALDRLAAY ELNGLSDSAK AKTTNGMSYI VDELDGATAY  360
SGGGTAHTSS LTGDGDGDLW SLARSASSLH ADSMINCFNA VGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-471119015170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2491200.0AK249120.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf17a09, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701038.11e-144PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP64e-95NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM8C7C30.0M8C7C3_AEGTA; NAC domain-containing protein 43
STRINGMLOC_75524.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.19e-86NAC family protein